HPA030273

antibody from Atlas Antibodies

Targeting: ITPKB IP3-3KB, IP3KB

Antibody data

Submit

Validation data

Product number: HPA030273 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA030273, RRID:AB_10601127
Product name: Anti-ITPKB
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: PDKPFLRKACSPSNIPAVIITDMGTQEDGALEETQ GSPRGNLPLRKLSSSSASSTGFSSSYEDSEEDISS DPE
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

ITPKB protein structure - HPA030273 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human cerebral cortex and liver tissues using HPA030273 antibody. Corresponding ITPKB RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows strong positivity in astrocytes.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human prostate shows strong cytoplasmic positivity in smooth muscle cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in white matter.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in glial cells.
Sample type: HUMAN