Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001130-M07 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001130-M07, RRID:AB_1679128
- Product name
- LYST monoclonal antibody (M07), clone 3H1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant LYST.
- Antigen sequence
MSTDSNSLAREFLTDVNRLCNAVVQRVEAREEEEE
ETHMATLGQYLVHGRGFLLLTKLNSIIDQALTCRE
ELLTLLLSLLPLVWKIPVQEEKATDFNLPL- Isotype
- IgG
- Antibody clone number
- 3H1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Chediak-Higashi syndrome: description of two novel homozygous missense mutations causing divergent clinical phenotype.
Sánchez-Guiu I, Antón AI, García-Barberá N, Navarro-Fernández J, Martínez C, Fuster JL, Couselo JM, Ortuño FJ, Vicente V, Rivera J, Lozano ML
European journal of haematology 2014 Jan;92(1):49-58
European journal of haematology 2014 Jan;92(1):49-58
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged LYST is 0.03 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol