Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00064216-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00064216-M01, RRID:AB_1581301
- Product name
- TFB2M monoclonal antibody (M01), clone 2E10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant TFB2M.
- Antigen sequence
YLIQMIPRQNLFTKNLTPMNYNIFFHLLKHCFGRR
SATVIDHLRSLTPLDARDILMQIGKQEDEKVVNMH
PQDFKTLFETIERSKDCAYKWLYDETLEDR- Isotype
- IgG
- Antibody clone number
- 2E10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- TFB2M monoclonal antibody (M01), clone 2E10. Western Blot analysis of TFB2M expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- TFB2M monoclonal antibody (M01), clone 2E10. Western Blot analysis of TFB2M expression in human kidney.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged TFB2M is 0.03 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol