Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006285-M52 - Provider product page
- Provider
- Abnova Corporation
- Product name
- S100B monoclonal antibody (M52), clone 2A10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full-length recombinant S100B.
- Antigen sequence
MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKE
LINNELSHFLEEIKEQEVVDKVMETLDNDGDGECD
FQEFMAFVAMVTTACHEFFEHE- Isotype
- IgG
- Antibody clone number
- 2A10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Magnetic bead-quantum dot assay for detection of a biomarker for traumatic brain injury.
Kim C, Searson PC
Nanoscale 2015 Nov 14;7(42):17820-6
Nanoscale 2015 Nov 14;7(42):17820-6
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged S100B is 0.03 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to S100B on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol