HPA001812
antibody from Atlas Antibodies
Targeting: APOBEC3G
bK150C2.7, CEM15, dJ494G10.1, FLJ12740, MDS019
Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunohistochemistry [7]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA001812 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA001812, RRID:AB_1078175
- Product name
- Anti-APOBEC3G
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
MHNDTWVLLNQRRGFLCNQAPHKHGFLEGRHAELC
FLDVIPFWKLDLDQDYRVTCFTSWSPCFSCAQEMA
KFISKNKHVSLCIFTARIYDDQGRCQEGLRTLAEA
GAKISIMTYSEFKHCWDTFVDHQGCPFQPWDGLDE
HSQDLSGRL- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Type I interferon responses in rhesus macaques prevent SIV infection and slow disease progression.
Immune clearance of highly pathogenic SIV infection
Sandler NG, Bosinger SE, Estes JD, Zhu RT, Tharp GK, Boritz E, Levin D, Wijeyesinghe S, Makamdop KN, del Prete GQ, Hill BJ, Timmer JK, Reiss E, Yarden G, Darko S, Contijoch E, Todd JP, Silvestri G, Nason M, Norgren RB Jr, Keele BF, Rao S, Langer JA, Lifson JD, Schreiber G, Douek DC
Nature 2014 Jul 31;511(7511):601-5
Nature 2014 Jul 31;511(7511):601-5
Immune clearance of highly pathogenic SIV infection
Hansen S, Jr M, Ventura A, Hughes C, Gilbride R, Ford J, Oswald K, Shoemaker R, Li Y, Lewis M, Gilliam A, Xu G, Whizin N, Burwitz B, Planer S, Turner J, Legasse A, Axthelm M, Nelson J, Früh K, Sacha J, Estes J, Keele B, Edlefsen P, Lifson J, Picker L
Nature 2013 September;502(7469):100-104
Nature 2013 September;502(7469):100-104
No comments: Submit comment
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human lymph node and pancreas tissues using HPA001812 antibody. Corresponding APOBEC3G RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human spleen shows strong cytoplasmic positivity in cells in red pulp.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lymph node shows moderate to strong cytoplasmic positivity in lymphoid cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human spleen shows moderate to strong cytoplasmic positivity in cells in red pulp.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human stomach shows moderate to strong cytoplasmic positivity in lymphoid cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows no positivity as expected.
- Sample type
- HUMAN