HPA002736

antibody from Atlas Antibodies

Targeting: CFAP57 FLJ32000, WDR65

Antibody data

Submit

Validation data

Product number: HPA002736 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA002736, RRID:AB_2272982
Product name: Anti-CFAP57
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: PESNLVYWLWEKQKVMAIVRIDTQNNPVYQVSFSP QDNTQVCVTGNGMFKLLRFAEGTLKQTSFQRGEPQ NYLAHTWVADDKIVVGTDTGKLFLFESGDQRWETS IMVKEPTNGSKSLDVIQESESLIEFPPVSSPLP
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

CFAP57 protein structure - HPA002736 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human fallopian tube and prostate tissues using HPA002736 antibody. Corresponding CFAP57 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human fallopian tube, liver, lymph node and prostate using Anti-CFAP57 antibody HPA002736 (A) shows similar protein distribution across tissues to independent antibody HPA028623 (B).
Antibody #2 product nr: HPA028623
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human fallopian tube shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human prostate shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-CFAP57 antibody HPA002736.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-CFAP57 antibody HPA002736.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human prostate shows no positivity in glandular cells as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human Fallopian tube shows strong positivity in cilia in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node shows no positivity in lymphoid cells as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.
Sample type: HUMAN