WH0008372M1

HYAL3 antibody from MilliporeSigma / Merck KGaA
LUCA-3, LUCA14, Minna14
ELISA
Recommended by provider

Antibody data

Product number
WH0008372M1
Provider
MilliporeSigma / Merck KGaA
Product name
Monoclonal Anti-HYAL3 antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - WH0008372M1
Antibody type
Monoclonal
Antigen
HYAL3 (AAH05896, a.a. 1-418) full length recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MTTQLGPALVLGVALCLGCGQPLPQVPERPFSVLW
NVPSAHCEARFGVHLPLNSLGIIANRGQHFHGQNM
TIFYKNQLGLYPYFGPRGTAHNGGIPQALPLDRHL
ALAAYQIHHSLRPGFAGPAVLDWEEWCPLWAGNWG
RRRAYQAASWAWAQQVFPDLDPQEQLYKAYTGFEQ
AARALMEDTLRVAQALRPHGLWGFYHYPACGNGWH
SMASNYTGRCHAATLARNTQLHWLWAASSALFPSI
YLPPRLPPAH (without GST)
Isotype
IgG
Storage
-20C