H00008372-D01

HYAL3 antibody from Abnova Corporation
LUCA-3, LUCA14, Minna14

Antibody data

Product number
H00008372-D01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00008372-D01, RRID:AB_10720103
Product name
HYAL3 MaxPab rabbit polyclonal antibody (D01)
Provider product page
Abnova Corporation - H00008372-D01
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against a full-length human HYAL3 protein.
Antigen sequence
MTTQLGPALVLGVALCLGCGQPLPQVPERPFSVLW
NVPSAHCEARFGVHLPLNSLGIIANRGQHFHGQNM
TIFYKNQLGLYPYFGPRGTAHNGGIPQALPLDRHL
ALAAYQIHHSLRPGFAGPAVLDWEEWCPLWAGNWG
RRRAYQAASWAWAQQVFPDLDPQEQLYKAYTGFEQ
AARALMEDTLRVAQALRPHGLWGFYHYPACGNGWH
SMASNYTGRCHAATLARNTQLHWLWAASSALFPSI
YLPPRLPPAHHQAFVRHRLEEAFRVALVGHRHPLP
VLAYVRLTHRRSGRFLSQDDLVQSIGVSAALGAAG
VVLWGDLSLSSSEEECWHLHDYLVDTLGPYVINVT
RAAMACSHQRCHGHGRCARRDPGQMEAFLHLWPDG
SLGDWKSFSCHCYWGWAGPTCQEPRPGPKEAV
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.