AMAb91561

antibody from Atlas Antibodies

Targeting: AMACR P504S, RACE

Antibody data

Submit

Validation data

Product number: AMAb91561 - Provider product page
Provider: Atlas Antibodies
Product name: Anti-AMACR
Antibody type: Monoclonal
Reactivity: Human
Host: Mouse
Conjugate: Unconjugated
Antigen sequence: APFYTTYRTADGEFMAVGAIEPQFYELLIKGLGLK SDELPNQMSMDDWPEMKKKFADVFAKKTKAEWCQI FDGTDACVTPVLTF
Epitope: Binds to an epitope located within the peptide sequence EPQFYELLIK as determined by overlapping synthetic peptides.
Isotype: IgG
Antibody clone number: CL9360
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

AMACR protein structure - AMAb91561 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human kidney and skeletal muscle tissues using AMAb91561 antibody. Corresponding AMACR RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows weak granular cytoplasmic positivity in islets of Langerhans.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver cancer shows moderate granular cytoplasmic positivity in tumor cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows moderate granular cytoplasmic positivity in hepatocytes.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows strong granular cytoplasmic positivity in cells in proximal tubules.