Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005534-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005534-M01, RRID:AB_425610
- Product name
- PPP3R1 monoclonal antibody (M01), clone 4E1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant PPP3R1.
- Antigen sequence
MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNS
GSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEV
DFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDG
YISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINA
DKDGDGRISFEEFCAVVGGLDIHKKMVVDV- Isotype
- IgG
- Antibody clone number
- 4E1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Placenta-specific miRNA (miR-512-3p) targets PPP3R1 encoding the calcineurin B regulatory subunit in BeWo cells.
Kurashina R, Kikuchi K, Iwaki J, Yoshitake H, Takeshita T, Takizawa T
The journal of obstetrics and gynaecology research 2014 Mar;40(3):650-60
The journal of obstetrics and gynaecology research 2014 Mar;40(3):650-60
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- PPP3R1 monoclonal antibody (M01), clone 4E1. Western Blot analysis of PPP3R1 expression in rat brain.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged PPP3R1 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to PPP3R1 on HeLa cell. [antibody concentration 25 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol