HPA056520

antibody from Atlas Antibodies

Targeting: PACSIN2 SDPII

Antibody data

Submit

Validation data

Product number: HPA056520 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA056520, RRID:AB_2683163
Product name: Anti-PACSIN2
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: FEEKRLRFFREVLLEVQKHLDLSNVAGYKAIYHDL EQSIRAADAVEDLR
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

PACSIN2 protein structure - HPA056520 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human adrenal gland and skeletal muscle tissues using Anti-PACSIN2 antibody. Corresponding PACSIN2 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, kidney, lymph node and testis using Anti-PACSIN2 antibody HPA056520 (A) shows similar protein distribution across tissues to independent antibody HPA049854 (B).
Antibody #2 product nr: HPA049854
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in renal tubules.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human adrenal gland shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-PACSIN2 antibody HPA056520.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-PACSIN2 antibody HPA056520.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-PACSIN2 antibody HPA056520.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-PACSIN2 antibody HPA056520.
Sample type: HUMAN