Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB21786 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#PAB21786, RRID:AB_10984387
- Product name
- PGBD3 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant PGBD3.
- Antigen sequence
VYNQFMGGVDRADENIDKYRASIRGKKWYSSPLLF
CFELVLQNAWQLHKTYDEKPVDFLEFRRRVVCHYL
ETHGHPPEPGQKGRPQKRNIDSRYDGINHVIVKQG
KQTRCAECHKNTTFRCEKCDVALHVKCSVEY- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Submitted references CSB-PGBD3 Mutations Cause Premature Ovarian Failure.
Qin Y, Guo T, Li G, Tang TS, Zhao S, Jiao X, Gong J, Gao F, Guo C, Simpson JL, Chen ZJ
PLoS genetics 2015 Jul;11(7):e1005419
PLoS genetics 2015 Jul;11(7):e1005419
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with PGBD3 polyclonal antibody (Cat # PAB21786).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human heart muscle with PGBD3 polyclonal antibody (Cat # PAB21786) shows strong cytoplasmic positivity at 1:20-1:50 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)