AMAb91033

GFAP antibody from Atlas Antibodies
FLJ45472
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
AMAb91033
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#AMAb91033, RRID:AB_2665775
Product name
Anti-GFAP
Provider product page
Atlas Antibodies - AMAb91033
Antibody type
Monoclonal
Reactivity
Human, Mouse, Rat
Host
Mouse
Conjugate
Unconjugated
Antigen sequence
LEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHL
KRNIVVKTVEMRDGEVIKESKQEHKD
Epitope
Binds to an epitope located within the peptide sequence PVQTFSNLQIRETSL as determined by overlapping synthetic peptides.
Isotype
IgG
Antibody clone number
CL2713
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -