AMAb91033

antibody from Atlas Antibodies

Targeting: GFAP FLJ45472

Western blot (Enhanced validation)

Immunohistochemistry (Enhanced validation)

Antibody Data

Product number

AMAb91033

Provider

Atlas Antibodies

Proper citation

Atlas Antibodies Cat#AMAb91033, RRID:AB_2665775

Product name

Anti-GFAP

Antibody type

Monoclonal

Reactivity

Human, Mouse, Rat

Host

Mouse

Conjugate

Unconjugated

Antigen sequence

LEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHL
KRNIVVKTVEMRDGEVIKESKQEHKD


Epitope

Binds to an epitope located within the peptide sequence PVQTFSNLQIRETSL as determined by overlapping synthetic peptides.

Isotype

IgG

Antibody clone number

CL2713

Vial size

100 µl

Storage

Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Western blot

Enhanced validation

Submitted by

Atlas Antibodies (provider)

Enhanced method

Genetic validation

Main image

Experimental details

Western blot analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-GFAP antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Mouse Cerebral Cortex tissue

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Western blot analysis in mouse cerebral cortex tissue.

Immunohistochemistry

Enhanced validation

Submitted by

Atlas Antibodies (provider)

Enhanced method

Orthogonal validation

Main image

Experimental details

Immunohistochemistry analysis in human cerebral cortex and tonsil tissues using AMAb91033 antibody. Corresponding GFAP RNA-seq data are presented for the same tissues.

Sample type

HUMAN

Orthogonal method

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Show more

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of rat hippocampus shows strong immunoreactivity in astrocytes.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of mouse cerebellum shows strong positivity in astrocytes.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human cerebral cortex shows strong immunoreactivity in astrocytes.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of rat cerebellum shows strong positivity in astrocytes.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of mouse hypothalamus shows strong immunoreactivity in astrocytes.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human tonsil shows absence of immunoreactivity (negative control).

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunofluorescence staining of rat brain shows strong positivity in astrocytes in the hippocampus.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunofluorescence staining of rat brain shows strong positivity in astrocytes in the cerebellum.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunofluorescence staining of mouse brain shows strong positivity in astrocytes in the cerebellum.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunofluorescence staining of mouse brain shows strong positivity in astrocytes in the brainstem.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in astrocytes.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human tonsil shows no positivity in lymphoid cells as expected.