Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA001817 - Provider product page
- Provider
- MilliporeSigma / Merck KGaA
- Product name
- Anti-CFB
- Antibody type
- Polyclonal
- Antigen
- Complement factor B precursor (contains complement factor B Ba fragment and complement factor B Bb fragment) recombinant protein epitope signature tag (PrEST)
- Description
- affinity isolated antibody
- Reactivity
- Human
- Antigen sequence
KDNEQHVFKVKDMENLEDVFYQMIDESQSLSLCGM
VWEHRKGTDYHKQPWQAKISVIRPSKGHESCMGAV
VSEYFVLTAAHCFTVDDKEHSIKVSVGGEKRDLEI
EVVLFHPNYNINGKKEAGIPEFYDYDVALIKLKNK
LKYG- Storage
- -20C
Submitted references Cancer genetics-guided discovery of serum biomarker signatures for diagnosis and prognosis of prostate cancer.
Cima I, Schiess R, Wild P, Kaelin M, Schüffler P, Lange V, Picotti P, Ossola R, Templeton A, Schubert O, Fuchs T, Leippold T, Wyler S, Zehetner J, Jochum W, Buhmann J, Cerny T, Moch H, Gillessen S, Aebersold R, Krek W
Proceedings of the National Academy of Sciences of the United States of America 2011 Feb 22;108(8):3342-7
Proceedings of the National Academy of Sciences of the United States of America 2011 Feb 22;108(8):3342-7
No comments: Submit comment
No validations: Submit validation data