HPA030453

TNFRSF13B antibody from Atlas Antibodies
CD267, IGAD2, TACI
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA030453
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA030453, RRID:AB_10601700
Product name
Anti-TNFRSF13B
Provider product page
Atlas Antibodies - HPA030453
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ACFLKKRGDPCSCQPRSRPRQSPAKSSQDHAMEAG
SPVSTSPEPVETCSFCFPECRAPTQESAVTPGTPD
PTCAGRWGCHTRTTVLQPCPHIPDSGLGIVCVPAQ
E
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -