HPA027066

antibody from Atlas Antibodies

Targeting: FN1 CIG, FINC, GFND2, LETS, MSF

Antibody data

Submit

Validation data

Product number: HPA027066 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA027066, RRID:AB_10602500
Product name: Anti-FN1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: HEEICTTNEGVMYRIGDQWDKQHDMGHMMRCTCVG NGRGEWTCIAYSQLRDQCIVDDITYNVNDTFHKRH EEGHMLNCTCFGQGRGRWKCDPVDQCQDSETGTFY QIGDSWEKYVHGVRYQCYCYGRGIG
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

FN1 protein structure - HPA027066 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human placenta and pancreas tissues using HPA027066 antibody. Corresponding FN1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in subsets of tubules.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lung shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows strong positivity in plasma.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skin shows moderate positivity in dermis.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows low positivity in exocrine glandular cells as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human placenta shows very strong positivity in plasma.
Sample type: HUMAN