HPA031383

CCR7 antibody from Atlas Antibodies
BLR2, CD197, CDw197, CMKBR7, EBI1

Antibody data

Product number
HPA031383
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA031383, RRID:AB_2673854
Product name
Anti-CCR7
Provider product page
Atlas Antibodies - HPA031383
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GVKFRNDLFKLFKDLGCLSQEQLRQWSSCRHIRRS
SMSVEAETTTTFS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -