HPA078657

antibody from Atlas Antibodies

Targeting: TBR1

Antibody data

Submit

Validation data

Product number: HPA078657 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA078657, RRID:AB_2732388
Product name: Anti-TBR1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: LLSQSSQPQSAATAPSAMFPYPGQHGPAHPAFSIG SPSRYMAHHPVITNGAYNSLLSNSSPQGYPTAGYP YPQQYG
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

TBR1 protein structure - HPA078657 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human cerebral cortex and kidney tissues using Anti-TBR1 antibody. Corresponding TBR1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, kidney, liver and lymph node using Anti-TBR1 antibody HPA078657 (A) shows similar protein distribution across tissues to independent antibody HPA078644 (B).
Antibody #2 product nr: HPA078644
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-TBR1 antibody HPA078657.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-TBR1 antibody HPA078657.
Sample type: HUMAN