Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004535-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004535-A01, RRID:AB_606641
- Product name
- ND1 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant ND1.
- Antigen sequence
MLTERKILGYIQLRKGPNVVGPYGLLQPFADAIKL
FTKEPLKPATSTITLY- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Exercise Intolerance and Myoglobinuria Associated with a Novel Maternally Inherited MT-ND1 Mutation.
Changes in mitochondrial energy utilization in young and old worker honeybees (Apis mellifera).
Defective DNA replication impairs mitochondrial biogenesis in human failing hearts.
Rafiq J, Duno M, Østergaard E, Ravn K, Vissing CR, Wibrand F, Vissing J
JIMD reports 2016;25:65-70
JIMD reports 2016;25:65-70
Changes in mitochondrial energy utilization in young and old worker honeybees (Apis mellifera).
Chuang YL, Hsu CY
Age (Dordrecht, Netherlands) 2013 Oct;35(5):1867-79
Age (Dordrecht, Netherlands) 2013 Oct;35(5):1867-79
Defective DNA replication impairs mitochondrial biogenesis in human failing hearts.
Karamanlidis G, Nascimben L, Couper GS, Shekar PS, del Monte F, Tian R
Circulation research 2010 May 14;106(9):1541-8
Circulation research 2010 May 14;106(9):1541-8
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- ND1 polyclonal antibody (A01), Lot # NIH48060209QCS1 Western Blot analysis of ND1 expression in HepG2 ( Cat # L019V1 ).