HPA054203

PRKCB antibody from Atlas Antibodies
PKC?, PKCB, PRKCB1, PRKCB2

Antibody data

Product number
HPA054203
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA054203, RRID:AB_2682416
Product name
Anti-PRKCB
Provider product page
Atlas Antibodies - HPA054203
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RQKFERAKISQGTKVPEEKTTNTVSKFDNNGNRDR
MKLTD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -