Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002213-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002213-M01, RRID:AB_1016667
- Product name
- FCGR2B monoclonal antibody (M01), clone 2E10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant FCGR2B.
- Antigen sequence
AAPPKAVLKLEPQWINVLQEDSVTLTCRGTHSPES
DSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQ
TGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIV
VRCHS- Isotype
- IgG
- Antibody clone number
- 2E10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- FCGR2B monoclonal antibody (M01), clone 2E10 Western Blot analysis of FCGR2B expression in K-562 ( Cat # L009V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of FCGR2B expression in transfected 293T cell line by FCGR2B monoclonal antibody (M01), clone 2E10.Lane 1: FCGR2B transfected lysate(34 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged FCGR2B is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to FCGR2B on formalin-fixed paraffin-embedded human placenta. [antibody concentration 6 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
