H00001364-B01

CLDN4 antibody from Abnova Corporation
CPE-R, CPETR, CPETR1, hCPE-R, WBSCR8

Antibody data

Product number
H00001364-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001364-B01, RRID:AB_1113386
Product name
CLDN4 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00001364-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human CLDN4 protein.
Antigen sequence
MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAF
IGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSL
LALPQDLQAARALVIISIIVAALGVLLSVVGGKCT
NCLEDESAKAKTMIVAGVVFLLAGLMVIVPVSWTA
HNIIQDFYNPLVASGQKREMGASLYVGWAASGLLL
LGGGLLCCNCPPRTDKPYSAKYSAARSAAASNYV
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -