SAB1401079

CLDN4 antibody from Sigma-Aldrich
CPE-R, CPETR, CPETR1, hCPE-R, WBSCR8
Flow cytometry
Recommended by provider

Antibody data

Product number
SAB1401079
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB1401079, RRID:AB_10609816
Product name
Anti-CLDN4 antibody produced in mouse
Provider product page
Sigma-Aldrich - SAB1401079
Antibody type
Polyclonal
Antigen
CLDN4 (NP_001296.1, 1 a.a. ~ 209 a.a) full-length human protein.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAF
IGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSL
LALPQDLQAARALVIISIIVAALGVLLSVVGGKCT
NCLEDESAKAKTMIVAGVVFLLAGLMVIVPVSWTA
HNIIQDFYNPLVASGQKREMGASLYVGWAASGLLL
LGGGLLCCNCPPRTDKPYSAKYSAARSAAASNYV
Storage
-20C
Provider Type Product Number
- No reagents -