HPA044637

antibody from Atlas Antibodies

Targeting: GAD2 GAD65

Antibody data

Submit

Validation data

Product number: HPA044637 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA044637, RRID:AB_10794053
Product name: Anti-GAD2
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: SGFWSFGSEDGSGDSENPGTARAWCQVAQKFTGGI GNKLCALLYGDAEKPAESGGSQPPRAAARKAACAC DQKPCSCSKVDVNYAFLHATDLLP
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

GAD2 protein structure - HPA044637 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human cerebral cortex and skeletal muscle tissues using HPA044637 antibody. Corresponding GAD2 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows cytoplasmic positivity in islets of Langerhans.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows strong granular cytoplasmic positivity in islets of Langerhans.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows moderate granular cytoplasmic positivity in neuropil.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebellum shows moderate granular cytoplasmic positivity in cells in molecular layer.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows no granular cytoplasmic positivity in myocytes as expected.
Sample type: HUMAN