HPA051452

antibody from Atlas Antibodies

Targeting: DBN1 D0S117E

Antibody data

Submit

Validation data

Product number: HPA051452 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA051452, RRID:AB_2681489
Product name: Anti-DBN1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: PSPILDSEETRAAAPQAWAGPMEEPPQAQAPPRGP GSPAEDLMFMESAEQAVLAAPVEPATADATEIHDA ADTIETDTATADTTVANNVPPAATSLIDLWP
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

DBN1 protein structure - HPA051452 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-DBN1 antibody. Corresponding DBN1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, kidney, pancreas and testis using Anti-DBN1 antibody HPA051452 (A) shows similar protein distribution across tissues to independent antibody HPA056940 (B).
Antibody #2 product nr: HPA056940
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in neuropil.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-DBN1 antibody HPA051452.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-DBN1 antibody HPA051452.
Sample type: HUMAN