HPA063887

antibody from Atlas Antibodies

Targeting: PRPH NEF4, PRPH1

Antibody data

Submit

Validation data

Product number: HPA063887 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA063887, RRID:AB_2685142
Product name: Anti-PRPH
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: EESRISVPVHSFASLNIKTTVPEVEPPQDSHSRKT VLIKTI
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

PRPH protein structure - HPA063887 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, colon, liver and rectum using Anti-PRPH antibody HPA063887 (A) shows similar protein distribution across tissues to independent antibody HPA039277 (B).
Antibody #2 product nr: HPA039277
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node shows moderate cytoplasmic positivity in germinal center cells and non-germinal center cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human rectum using Anti-PRPH antibody HPA063887.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-PRPH antibody HPA063887.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-PRPH antibody HPA063887.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-PRPH antibody HPA063887.
Sample type: HUMAN