AV09001

DOK1 antibody from MilliporeSigma / Merck KGaA
p62dok
No application information provided.

Antibody data

Product number
AV09001
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-DOK1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - AV09001
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human DOK1 with an internal ID of P00330
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EPGTATGSGIKSHNSALYSQVQKSGASGSWDCGLS
RVGTDKTGVKSEGST
Storage
-20C