HPA046964

antibody from Atlas Antibodies

Targeting: ANXA2 ANX2, ANX2L4, CAL1H, LIP2, LPC2D

Antibody data

Submit

Validation data

Product number: HPA046964 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA046964, RRID:AB_2732537
Product name: Anti-ANXA2
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: MGRQLAGCGDAGKKASFKMSTVHEILCKLSLEGDH STPPSAYGSVKAYTNFDAERDALNIETAIKTKGVD EVTIVNI
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

ANXA2 protein structure - HPA046964 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human lung and cerebral cortex tissues using Anti-ANXA2 antibody. Corresponding ANXA2 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, kidney, liver and lung using Anti-ANXA2 antibody HPA046964 (A) shows similar protein distribution across tissues to independent antibody HPA061798 (B).
Antibody #2 product nr: HPA061798
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lung shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-ANXA2 antibody HPA046964.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-ANXA2 antibody HPA046964.
Sample type: HUMAN