HPA017009

APBB1IP antibody from Atlas Antibodies
INAG1, RIAM
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA017009
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA017009, RRID:AB_2669505
Product name
Anti-APBB1IP
Provider product page
Atlas Antibodies - HPA017009
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MGESSEDIDQMFSTLLGEMDLLTQSLGVDTLPPPD
PNPPRAEFNYSVGFKDLNESLNALEDQDLDALMAD
LVADISEAEQRTIQAQKESLQNQHHSASLQASIFS
GAASLGYGTNVAATGISQYEDDLPPPPADPVLDLP
LPPP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -