HPA052904

DFFB antibody from Atlas Antibodies
CAD, CPAN, DFF-40, DFF40

Antibody data

Product number
HPA052904
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA052904, RRID:AB_2681985
Product name
Anti-DFFB
Provider product page
Atlas Antibodies - HPA052904
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EAQEEFLRVLGSMCQRLRSMQYNGSYFDRGAKGGS
RLCTPEGWFSCQGPFDMDSCLSRHSINPYSNRESR
ILFSTWN
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.