H00011083-M04
antibody from Abnova Corporation
Targeting: DIDO1
BYE1, C20orf158, DATF1, DIO-1, DIO1, dJ885L7.8, FLJ11265, KIAA0333
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00011083-M04 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00011083-M04, RRID:AB_10721379
- Product name
- DIDO1 monoclonal antibody (M04), clone 3B1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant DIDO1.
- Antigen sequence
ILQVQDETHSETADQQEAKWRPGDADGTDCTSIGT
IEQKSSEDQGIKGRIEKAANPSGKKKLKIFQPVIE
APGASKCIGPGCCHVAQPDSVYCSNDCILK- Isotype
- IgG
- Antibody clone number
- 3B1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- DIDO1 monoclonal antibody (M04), clone 3B1. Western Blot analysis of DIDO1 expression in HepG2(Cat # L019V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged DIDO1 is 0.03 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to DIDO1 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol