H00009456-D01

HOMER1 antibody from Abnova Corporation
HOMER-1B, SYN47, Ves-1

Antibody data

Product number
H00009456-D01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00009456-D01, RRID:AB_10720104
Product name
HOMER1 MaxPab rabbit polyclonal antibody (D01)
Provider product page
Abnova Corporation - H00009456-D01
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against a full-length human HOMER1 protein.
Antigen sequence
MGEQPIFSTRAHVFQIDPNTKKNWVPTSKHAVTVS
YFYDSTRNVYRIISLDGSKAIINSTITPNMTFTKT
SQKFGQWADSRANTVYGLGFSSEHHLSKFAEKFQE
FKEAARLAKEKSQEKMELTSTPSQESAGGDLQSPL
TPESINGTDDERTPDVTQNSEPRAEPTQNALPFSH
SSAISKHWEAELATLKGNNAKLTAALLESTANVKQ
WKQQLAAYQEEAERLHKRVTELECVSSQANAVHTH
KTELNQTIQELEETLKLKEEEIERLKQEIDNAREL
QEQRDSLTQKLQEVEIRNKDLEGQLSDLEQRLEKS
QNEQEAFRNNLKTLLEILDGKIFELTELRDNLAKL
LECS
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -