ABIN184193
antibody from antibodies-online
Targeting: SERPINH1
CBP1, CBP2, colligen, HSP47, SERPINH2
Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN184193 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-serpin Peptidase Inhibitor, Clade H (Heat Shock Protein 47), Member 1, (Collagen Binding Protein 1) (SERPINH1) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SERPINH1 antibody: synthetic peptide directed towards the C terminal of human SERPINH1
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
DIYGREELRSPKLFYADHPFIFLVRDTQSGSLLFI
GRLVR LKGDKMRDEL- Epitope
- C-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Association between FOXP2 polymorphisms and schizophrenia with auditory hallucinations.
Cloning of a human collagen-binding protein, and its homology with rat gp46, chick hsp47 and mouse J6 proteins.
Sanjuán J, Tolosa A, González JC, Aguilar EJ, Pérez-Tur J, Nájera C, Moltó MD, de Frutos R
Psychiatric genetics 2006 Apr;16(2):67-72
Psychiatric genetics 2006 Apr;16(2):67-72
Cloning of a human collagen-binding protein, and its homology with rat gp46, chick hsp47 and mouse J6 proteins.
Clarke EP, Sanwal BD
Biochimica et biophysica acta 1992 Jan 6;1129(2):246-8
Biochimica et biophysica acta 1992 Jan 6;1129(2):246-8
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- WB Suggested Anti-SERPINH1 Antibody Positive Control: Lane 1:841 μg mouse brain extract Primary Antibody Dilution: 1:000Secondary Antibody: IRDye 800 CW goat anti-rabbit from Li-COR BioscienceSecondry Antibody Dilution: 1:00,000Submitted by: Dr. Yuzhi Chen, University of Arkansas for Medical Science
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- WB Suggested Anti-SERPINH1 Antibody Titration: 1.25 μg/mL Positive Control: Placenta cell lysate