HPA047213

antibody from Atlas Antibodies

Targeting: SIN3A DKFZP434K2235, KIAA0700

Antibody data

Submit

Validation data

Product number: HPA047213 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA047213, RRID:AB_2679984
Product name: Anti-SIN3A
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: SDDPVEAERWSDYVERYMNSDTTSPELREHLAQKP VFLPRNLRRIRKCQRGREQQEKEGKEGNSKKTMEN VDSLDKLECRFKLNSYKMVYVIKSEDYMYRRTALL RAHQSHERVSK
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

SIN3A protein structure - HPA047213 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human testis and liver tissues using Anti-SIN3A antibody. Corresponding SIN3A RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human kidney, liver, skin and testis using Anti-SIN3A antibody HPA047213 (A) shows similar protein distribution across tissues to independent antibody HPA062123 (B).
Antibody #2 product nr: HPA062123
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skin using Anti-SIN3A antibody HPA047213.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-SIN3A antibody HPA047213.
Sample type: HUMAN