Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005337-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005337-M01, RRID:AB_464402
- Product name
- PLD1 monoclonal antibody (M01), clone 2F3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PLD1.
- Antigen sequence
GYLDDPSEDIQDPVSDKFFKEVWVSTAARNATIYD
KVFRCLPNDEVHNLIQLRDFINKPVLAKEDPIRAE
EELKKIRGFLVQFPFYFLSEESLLPSVGTKEAIVP
MEVWT- Isotype
- IgG
- Antibody clone number
- 2F3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Mechanisms for the activity of heterocyclic cyclohexanone curcumin derivatives in estrogen receptor negative human breast cancer cell lines.
Somers-Edgar TJ, Taurin S, Larsen L, Chandramouli A, Nelson MA, Rosengren RJ
Investigational new drugs 2011 Feb;29(1):87-97
Investigational new drugs 2011 Feb;29(1):87-97
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of PLD1 expression in transfected 293T cell line by PLD1 monoclonal antibody (M01), clone 2F3.Lane 1: PLD1 transfected lysate(124.2 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged PLD1 is 0.03 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol