Explore
Validate
LearnHPA000612
antibody from Atlas Antibodies
Targeting: APOOL
AAIR8193, CXorf33, FAM121A, Mic27, MICOS27, UNQ8193
Western blot
ImmunocytochemistryAntibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [5]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA000612 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA000612, RRID:AB_1078594
- Product name
- Anti-APOOL
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
ATLGATVCYPVQSVIIAKVTAKKVYATSQQIFGAV
KSLWTKSSKEESLPKPKEKTKLGSSSEIEVPAKTT
HVLKHSVPLPTELSSEAKTKSESTSGATQFMPDPK
LMDHGQSHPED- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references APOOL is a cardiolipin-binding constituent of the Mitofilin/MINOS protein complex determining cristae morphology in mammalian mitochondria.
Tissue profiling of the mammalian central nervous system using human antibody-based proteomics.
Systematically generated antibodies against human gene products: high throughput screening on sections from the rat nervous system.
Weber TA, Koob S, Heide H, Wittig I, Head B, van der Bliek A, Brandt U, Mittelbronn M, Reichert AS
PloS one 2013;8(5):e63683
PloS one 2013;8(5):e63683
Tissue profiling of the mammalian central nervous system using human antibody-based proteomics.
Mulder J, Björling E, Jonasson K, Wernérus H, Hober S, Hökfelt T, Uhlén M
Molecular & cellular proteomics : MCP 2009 Jul;8(7):1612-22
Molecular & cellular proteomics : MCP 2009 Jul;8(7):1612-22
Systematically generated antibodies against human gene products: high throughput screening on sections from the rat nervous system.
Mulder J, Wernérus H, Shi TJ, Pontén F, Hober S, Uhlén M, Hökfelt T
Neuroscience 2007 Jun 8;146(4):1689-703
Neuroscience 2007 Jun 8;146(4):1689-703
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Genetic validation
- Main image
- Experimental details
- Western blot analysis in Rh30 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-APOOL antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human placenta shows granular cytoplasmic positivity in trophoblastic cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows granular cytoplasmic positivity in cells in tubules.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows granular cytoplasmic positivity in exocrine glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human rectum shows granular cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN
