Explore
Validate
Learn
ImmunocytochemistryAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [5]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA000511 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA000511, RRID:AB_1079505
- Product name
- Anti-HMGN5
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
LSAMLVPVTPEVKPKRTSSSRKMKTKSDMMEENID
TSAQAVAETKQEAVVEEDYNENAKNGEAKITEAPA
SEKEIVEVKEENIEDATEKGGEKKEAVAAEVK- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references High mobility group protein N5 (HMGN5) and lamina-associated polypeptide 2α (LAP2α) interact and reciprocally affect their genome-wide chromatin organization.
Distinct properties of human HMGN5 reveal a rapidly evolving but functionally conserved nucleosome binding protein.
Zhang S, Schones DE, Malicet C, Rochman M, Zhou M, Foisner R, Bustin M
The Journal of biological chemistry 2013 Jun 21;288(25):18104-9
The Journal of biological chemistry 2013 Jun 21;288(25):18104-9
Distinct properties of human HMGN5 reveal a rapidly evolving but functionally conserved nucleosome binding protein.
Malicet C, Rochman M, Postnikov Y, Bustin M
Molecular and cellular biology 2011 Jul;31(13):2742-55
Molecular and cellular biology 2011 Jul;31(13):2742-55
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows strong nuclear positivity in subset of cells in seminiferous ducts.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human gastrointestinal shows strong nuclear positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human prostate shows strong nuclear positivity in glandular cells.
- Sample type
- HUMAN
