Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002597-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002597-A01, RRID:AB_462771
- Product name
- GAPDH polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant GAPDH.
- Antigen sequence
GKLTGMAFRVPTANVSVVDLTCRLEKPAKYDDIKK
VVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTF
DAGAGIALNDHFVKLISWYDNEFGYSNRVVDLMAH
MASKE- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Cyclic compression-induced p38 activation and subsequent MMP13 expression requires Rho/ROCK activity in bovine cartilage explants.
Nakagawa K, Teramura T, Takehara T, Onodera Y, Hamanishi C, Akagi M, Fukuda K
Inflammation research : official journal of the European Histamine Research Society ... [et al.] 2012 Oct;61(10):1093-100
Inflammation research : official journal of the European Histamine Research Society ... [et al.] 2012 Oct;61(10):1093-100
No comments: Submit comment
No validations: Submit validation data