HPA019057

CDKN2C antibody from Atlas Antibodies
INK4C, p18
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA019057
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019057, RRID:AB_1854865
Product name
Anti-CDKN2C
Provider product page
Atlas Antibodies - HPA019057
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVE
FLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSL
MQANG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -