Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- 101-M56 - Provider product page
- Provider
- ReliaTech GmbH
- Product name
- VEGF-A
- Antibody type
- Monoclonal
- Antigen
- recombinant human VEGF165
- Description
- antibody purified from hybridoma supernatant
- Reactivity
- Human
- Host
- Mouse
- Antigen sequence
APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDI
FQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVP
TEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECR
PKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCK
NTDSRCKARQLELNERTCRCDKPRR- Isotype
- IgG
- Antibody clone number
- (#3C5)
- Vial size
- 100 µl
- Storage
- Store lyophilized at 2-8°C for 6 months or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for one month or (in aliquots) at -20°C long term. Avoid repeated freezing and thawing.
- Handling
- Restore in sterile water to a concentration of 0.1-1.0 mg/ml. The antibody solution should be gently mixed before use.
Submitted references Reduction of circulating soluble Flt-1 alleviates preeclampsia-like symptoms in a mouse model
Bergmann A, Ahmad S, Cudmore M, Gruber A, Wittschen P, Lindenmaier W, Christofori G, Gross V, Gonzalves A, Gröne H, Ahmed A, Weich H
Journal of Cellular and Molecular Medicine 2010 June;14(6b):1857-1867
Journal of Cellular and Molecular Medicine 2010 June;14(6b):1857-1867
No comments: Submit comment
Supportive validation
- Submitted by
- ReliaTech GmbH (provider)
- Main image
- Experimental details
- Western blot analysis of human VEGF-A isoforms 121, 165 and 189 (all produced in E. coli) under reducing (left panel) and non-reducing conditions (right panel).
- Sample type
- Purified recombinant proteins
Supportive validation
- Submitted by
- ReliaTech GmbH (provider)
- Main image
- Experimental details
- VEGF-A Sandwich-ELISA using VEGF189 (Cat# 300-094) as standard. Mouse anti-human VEGF-A (Cat# 101-M56) was used as capture antibody, Biotinylated mouse anti-human VEGF-A #339 (Cat# 101-MBi60) was used for detection.