Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Proximity ligation assay [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007422-M05 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007422-M05, RRID:AB_1137532
- Product name
- VEGF monoclonal antibody (M05), clone 3F7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant VEGF.
- Antigen sequence
APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDI
FQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVP
TEESNITMQIMRIKPHQGQHIGEMSFLQHNKCEC- Isotype
- IgG
- Antibody clone number
- 3F7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Hypoxia-selective growth inhibition of cancer cells by furospinosulin-1, a furanosesterterpene isolated from an Indonesian marine sponge.
Arai M, Kawachi T, Setiawan A, Kobayashi M
ChemMedChem 2010 Nov 8;5(11):1919-26
ChemMedChem 2010 Nov 8;5(11):1919-26
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of VEGF expression in transfected 293T cell line by VEGF monoclonal antibody (M05), clone 3F7.Lane 1: VEGF transfected lysate(17.2 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged VEGF is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between PGF and VEGFA. HeLa cells were stained with anti-PGF rabbit purified polyclonal 1:1200 and anti-VEGFA mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)
