HPA069116

antibody from Atlas Antibodies

Targeting: VEGFA VEGF, VEGF-A, VPF

Antibody data

Submit

Validation data

Product number: HPA069116 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA069116, RRID:AB_2686089
Product name: Anti-VEGFA
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: KWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIE TLVDIFQEYPDEIEYIFKPSCVP
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

VEGFA protein structure - HPA069116 shown in red.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human breast shows cytoplasmic positivity in adipocytes.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human adipose tissue shows moderate cytoplasmic positivity in adipocytes.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human prostate shows moderate cytoplasmic and membranous positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.
Sample type: HUMAN