Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003549-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003549-M01, RRID:AB_837455
- Product name
- IHH monoclonal antibody (M01), clone 2G9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant IHH.
- Antigen sequence
ESGARVALSAVRPGDRVLAMGEDGSPTFSDVLIFL
DREPHRLRAFQVIETQDPPRRLALTPAHLLFTADN
HTEPAARFRATFASHVQPGQYVLVAGVPG- Isotype
- IgG
- Antibody clone number
- 2G9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Protease nexin 1 inhibits hedgehog signaling in prostate adenocarcinoma.
McKee CM, Xu D, Cao Y, Kabraji S, Allen D, Kersemans V, Beech J, Smart S, Hamdy F, Ishkanian A, Sykes J, Pintile M, Milosevic M, van der Kwast T, Zafarana G, Ramnarine VR, Jurisica I, Mallof C, Lam W, Bristow RG, Muschel RJ
The Journal of clinical investigation 2012 Nov;122(11):4025-36
The Journal of clinical investigation 2012 Nov;122(11):4025-36
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- IHH monoclonal antibody (M01), clone 2G9 Western Blot analysis of IHH expression in Jurkat ( Cat # L017V1 ).