HPA031847

antibody from Atlas Antibodies

Targeting: ATP6V1B1 ATP6B1, RTA1B, VATB, Vma2, VPP3

Antibody data

Submit

Validation data

Product number: HPA031847 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA031847, RRID:AB_2674072
Product name: Anti-ATP6V1B1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: MAMEIDSRPGGLPGSSCNLGAAREHMQAVTRNYIT HPRVTYRTVCSVNGPLVVLDRVKFAQYAEIV
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

ATP6V1B1 protein structure - HPA031847 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human kidney and liver tissues using HPA031847 antibody. Corresponding ATP6V1B1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows moderate to strong cytoplasmic positivity in cells in distal tubules.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human salivary gland shows strong cytoplasmic positivity in ductal cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human breast shows moderate cytoplasmic positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.
Sample type: HUMAN