HPA020136

antibody from Atlas Antibodies

Targeting: SERPINB5 maspin, PI5

Antibody data

Submit

Validation data

Product number: HPA020136 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA020136, RRID:AB_1856728
Product name: Anti-SERPINB5
Antibody type: Polyclonal
Reactivity: Human, Rat
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: KSLNLSTEFISSTKRPYAKELETVDFKDKLEETKG QINNSIKDLTDGHFENILADNSVNDQTKILVVNAA YFVGKWMKKFPESETKECPFRVNKT
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

SERPINB5 protein structure - HPA020136 shown in red.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Genetic validation
Main image
Experimental details: Western blot analysis in HeLa cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-SERPINB5 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Western blot analysis in human cell lines PC-3 and Caco-2 using Anti-SERPINB5 antibody. Corresponding SERPINB5 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
Orthogonal method: Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Sample type: RAT

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, liver, skin and testis using Anti-SERPINB5 antibody HPA020136 (A) shows similar protein distribution across tissues to independent antibody HPA019025 (B).
Antibody #2 product nr: HPA019025, HPA019132
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human oral mucosa shows strong positivity in squamous epithelial cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-SERPINB5 antibody HPA020136.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-SERPINB5 antibody HPA020136.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skin using Anti-SERPINB5 antibody HPA020136.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-SERPINB5 antibody HPA020136.
Sample type: HUMAN