Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010769-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010769-A01, RRID:AB_462093
- Product name
- PLK2 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant PLK2.
- Antigen sequence
DGGDLPSVTDIRRPRLYLLQWLKSDKALMMLFNDG
TFQVNFYHDHTKIIICSQNEEYLLTYINEDRISTT
FRLTTLLMSGCSSELKNRMEYALNMLLQRCN- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Parkinson-related parkin reduces α-Synuclein phosphorylation in a gene transfer model.
Calcipotriol affects keratinocyte proliferation by decreasing expression of early growth response-1 and polo-like kinase-2.
Khandelwal PJ, Dumanis SB, Feng LR, Maguire-Zeiss K, Rebeck G, Lashuel HA, Moussa CE
Molecular neurodegeneration 2010 Nov 4;5:47
Molecular neurodegeneration 2010 Nov 4;5:47
Calcipotriol affects keratinocyte proliferation by decreasing expression of early growth response-1 and polo-like kinase-2.
Kristl J, Slanc P, Krasna M, Berlec A, Jeras M, Strukelj B
Pharmaceutical research 2008 Mar;25(3):521-9
Pharmaceutical research 2008 Mar;25(3):521-9
No comments: Submit comment
No validations: Submit validation data