Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310967 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Dickkopf Homolog 1 (Xenopus Laevis) (DKK1) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-DKK1 antibody: synthetic peptide directed towards the C terminal of human DKK1
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Rabbit, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
CARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQ
RCYCG EGLSCRIQKD- Epitope
- C-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Reduced affinity to and inhibition by DKK1 form a common mechanism by which high bone mass-associated missense mutations in LRP5 affect canonical Wnt signaling.
Ai M, Holmen SL, Van Hul W, Williams BO, Warman ML
Molecular and cellular biology 2005 Jun;25(12):4946-55
Molecular and cellular biology 2005 Jun;25(12):4946-55
No comments: Submit comment
No validations: Submit validation data