HPA035874

antibody from Atlas Antibodies

Targeting: ADD1

Antibody data

Submit

Validation data

Product number: HPA035874 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA035874, RRID:AB_2674837
Product name: Anti-ADD1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: SQVLCGVVMDRSLVQGELVTASKAIIEKEYQPHVI VSTTGPNPFTTLTDRELEEYRREVERKQKGSEENL DEAREQKEKSPPDQP
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

ADD1 protein structure - HPA035874 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, colon, kidney and testis using Anti-ADD1 antibody HPA035874 (A) shows similar protein distribution across tissues to independent antibody HPA035873 (B).
Antibody #2 product nr: HPA035873
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in tubular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-ADD1 antibody HPA035874.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-ADD1 antibody HPA035874.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-ADD1 antibody HPA035874.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-ADD1 antibody HPA035874.
Sample type: HUMAN