HPA038140

antibody from Atlas Antibodies

Targeting: PLCD4

Antibody data

Submit

Validation data

Product number: HPA038140 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA038140, RRID:AB_2675856
Product name: Anti-PLCD4
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: GFTIVFHGRRSNLDLMANSVEEAQIWMRGLQLLVD LVTSMDHQERLDQWLSDWFQRGDKNQDGKMSFQEV QRLLH
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

PLCD4 protein structure - HPA038140 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human colon, liver, lymph node and testis using Anti-PLCD4 antibody HPA038140 (A) shows similar protein distribution across tissues to independent antibody HPA038139 (B).
Antibody #2 product nr: HPA038139
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in cells in seminiferus ducts.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-PLCD4 antibody HPA038140.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-PLCD4 antibody HPA038140.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-PLCD4 antibody HPA038140.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-PLCD4 antibody HPA038140.
Sample type: HUMAN