Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001901-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001901-M01, RRID:AB_464111
- Product name
- EDG1 monoclonal antibody (M01), clone 2E12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant EDG1.
- Antigen sequence
MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKL
NISADKENSIKL- Isotype
- IgG
- Antibody clone number
- 2E12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- EDG1 monoclonal antibody (M01), clone 2E12 Western Blot analysis of EDG1 expression in Jurkat ( Cat # L017V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of EDG1 expression in transfected 293T cell line by EDG1 monoclonal antibody (M01), clone 2E12.Lane 1: EDG1 transfected lysate(42.8 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged EDG1 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol